Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
WARS monoclonal antibody (M02), clone 3A12
Abnova
WARS monoclonal antibody (M02), clone 3A12
Ref: AB-H00007453-M02
WARS monoclonal antibody (M02), clone 3A12
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant WARS.
Información adicional
Size
100 ug
Gene Name
WARS
Gene Alias
GAMMA-2|IFI53|IFP53
Gene Description
tryptophanyl-tRNA synthetase
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,IP,ELISA,IF
Immunogen Prot. Seq
YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
WARS (NP_004175, 50 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
7453
Clone Number
3A12
Iso type
IgG2a Kappa
Enviar un mensaje
WARS monoclonal antibody (M02), clone 3A12
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*