TRPV1 polyclonal antibody (A01)
  • TRPV1 polyclonal antibody (A01)

TRPV1 polyclonal antibody (A01)

Ref: AB-H00007442-A01
TRPV1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TRPV1.
Información adicional
Size 50 uL
Gene Name TRPV1
Gene Alias DKFZp434K0220|VR1
Gene Description transient receptor potential cation channel, subfamily V, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7442

Enviar un mensaje


TRPV1 polyclonal antibody (A01)

TRPV1 polyclonal antibody (A01)