EZR MaxPab rabbit polyclonal antibody (D01)
  • EZR MaxPab rabbit polyclonal antibody (D01)

EZR MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007430-D01
EZR MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EZR protein.
Información adicional
Size 100 uL
Gene Name EZR
Gene Alias CVIL|CVL|DKFZp762H157|FLJ26216|MGC1584|VIL2
Gene Description ezrin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EZR (AAH13903.1, 1 a.a. ~ 586 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7430

Enviar un mensaje


EZR MaxPab rabbit polyclonal antibody (D01)

EZR MaxPab rabbit polyclonal antibody (D01)