VEGFC polyclonal antibody (A01)
  • VEGFC polyclonal antibody (A01)

VEGFC polyclonal antibody (A01)

Ref: AB-H00007424-A01
VEGFC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VEGFC.
Información adicional
Size 50 uL
Gene Name VEGFC
Gene Alias Flt4-L|VRP
Gene Description vascular endothelial growth factor C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VEGFC (NP_005420, 112 a.a. ~ 227 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7424

Enviar un mensaje


VEGFC polyclonal antibody (A01)

VEGFC polyclonal antibody (A01)