VEGFB monoclonal antibody (M03), clone 4H5
  • VEGFB monoclonal antibody (M03), clone 4H5

VEGFB monoclonal antibody (M03), clone 4H5

Ref: AB-H00007423-M03
VEGFB monoclonal antibody (M03), clone 4H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VEGFB.
Información adicional
Size 100 ug
Gene Name VEGFB
Gene Alias VEGFL|VRF
Gene Description vascular endothelial growth factor B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,ELISA
Immunogen Prot. Seq DAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VEGFB (NP_003368, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7423
Clone Number 4H5
Iso type IgG2b Kappa

Enviar un mensaje


VEGFB monoclonal antibody (M03), clone 4H5

VEGFB monoclonal antibody (M03), clone 4H5