VEGF MaxPab mouse polyclonal antibody (B01)
  • VEGF MaxPab mouse polyclonal antibody (B01)

VEGF MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00007422-B01
VEGF MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human VEGF protein.
Información adicional
Size 50 uL
Gene Name VEGFA
Gene Alias MGC70609|VEGF|VEGF-A|VPF
Gene Description vascular endothelial growth factor A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VEGF (ENSP00000361134, 1 a.a. ~ 147 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7422

Enviar un mensaje


VEGF MaxPab mouse polyclonal antibody (B01)

VEGF MaxPab mouse polyclonal antibody (B01)