VDAC1 monoclonal antibody (M05), clone 4C4
  • VDAC1 monoclonal antibody (M05), clone 4C4

VDAC1 monoclonal antibody (M05), clone 4C4

Ref: AB-H00007416-M05
VDAC1 monoclonal antibody (M05), clone 4C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VDAC1.
Información adicional
Size 100 ug
Gene Name VDAC1
Gene Alias MGC111064|PORIN|PORIN-31-HL
Gene Description voltage-dependent anion channel 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VDAC1 (AAH08482, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7416
Clone Number 4C4
Iso type IgG2a Kappa

Enviar un mensaje


VDAC1 monoclonal antibody (M05), clone 4C4

VDAC1 monoclonal antibody (M05), clone 4C4