VCP monoclonal antibody (M15), clone 2H5
  • VCP monoclonal antibody (M15), clone 2H5

VCP monoclonal antibody (M15), clone 2H5

Ref: AB-H00007415-M15
VCP monoclonal antibody (M15), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VCP.
Información adicional
Size 100 ug
Gene Name VCP
Gene Alias IBMPFD|MGC131997|MGC148092|MGC8560|TERA|p97
Gene Description valosin-containing protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq IHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VCP (AAH07562.2, 221 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7415
Clone Number 2H5
Iso type IgG2a Kappa

Enviar un mensaje


VCP monoclonal antibody (M15), clone 2H5

VCP monoclonal antibody (M15), clone 2H5