VCAM1 monoclonal antibody (M04), clone 1H6
  • VCAM1 monoclonal antibody (M04), clone 1H6

VCAM1 monoclonal antibody (M04), clone 1H6

Ref: AB-H00007412-M04
VCAM1 monoclonal antibody (M04), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant VCAM1.
Información adicional
Size 100 ug
Gene Name VCAM1
Gene Alias CD106|DKFZp779G2333|INCAM-100|MGC99561
Gene Description vascular cell adhesion molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VCAM1 (AAH17276, 1 a.a. ~ 739 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7412
Clone Number 1H6
Iso type IgG2b Kappa

Enviar un mensaje


VCAM1 monoclonal antibody (M04), clone 1H6

VCAM1 monoclonal antibody (M04), clone 1H6