VCAM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • VCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

VCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007412-D01P
VCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human VCAM1 protein.
Información adicional
Size 100 ug
Gene Name VCAM1
Gene Alias CD106|DKFZp779G2333|INCAM-100|MGC99561
Gene Description vascular cell adhesion molecule 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VCAM1 (NP_001069.1, 1 a.a. ~ 739 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7412

Enviar un mensaje


VCAM1 purified MaxPab rabbit polyclonal antibody (D01P)

VCAM1 purified MaxPab rabbit polyclonal antibody (D01P)