VAV1 monoclonal antibody (M03), clone 2C11
  • VAV1 monoclonal antibody (M03), clone 2C11

VAV1 monoclonal antibody (M03), clone 2C11

Ref: AB-H00007409-M03
VAV1 monoclonal antibody (M03), clone 2C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VAV1.
Información adicional
Size 100 ug
Gene Name VAV1
Gene Alias VAV
Gene Description vav 1 guanine nucleotide exchange factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VAV1 (AAH13361, 681 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7409
Clone Number 2C11
Iso type IgG2a Kappa

Enviar un mensaje


VAV1 monoclonal antibody (M03), clone 2C11

VAV1 monoclonal antibody (M03), clone 2C11