VASP purified MaxPab mouse polyclonal antibody (B01P)
  • VASP purified MaxPab mouse polyclonal antibody (B01P)

VASP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007408-B01P
VASP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VASP protein.
Información adicional
Size 50 ug
Gene Name VASP
Gene Alias -
Gene Description vasodilator-stimulated phosphoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAPKAES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VASP (AAH38224.1, 1 a.a. ~ 380 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7408

Enviar un mensaje


VASP purified MaxPab mouse polyclonal antibody (B01P)

VASP purified MaxPab mouse polyclonal antibody (B01P)