VARS monoclonal antibody (M01), clone 4B7
  • VARS monoclonal antibody (M01), clone 4B7

VARS monoclonal antibody (M01), clone 4B7

Ref: AB-H00007407-M01
VARS monoclonal antibody (M01), clone 4B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VARS.
Información adicional
Size 100 ug
Gene Name VARS
Gene Alias G7A|VARS1|VARS2
Gene Description valyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AVRLSNQGFQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMPQAPPSLCVTPYPEPSECSWKDP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VARS (NP_006286, 994 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7407
Clone Number 4B7
Iso type IgG2a Kappa

Enviar un mensaje


VARS monoclonal antibody (M01), clone 4B7

VARS monoclonal antibody (M01), clone 4B7