UROD polyclonal antibody (A01)
  • UROD polyclonal antibody (A01)

UROD polyclonal antibody (A01)

Ref: AB-H00007389-A01
UROD polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UROD.
Información adicional
Size 50 uL
Gene Name UROD
Gene Alias PCT
Gene Description uroporphyrinogen decarboxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UROD (NP_000365, 268 a.a. ~ 367 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7389

Enviar un mensaje


UROD polyclonal antibody (A01)

UROD polyclonal antibody (A01)