USP4 monoclonal antibody (M01), clone 5E12
  • USP4 monoclonal antibody (M01), clone 5E12

USP4 monoclonal antibody (M01), clone 5E12

Ref: AB-H00007375-M01
USP4 monoclonal antibody (M01), clone 5E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP4.
Información adicional
Size 100 ug
Gene Name USP4
Gene Alias MGC149848|MGC149849|UNP|Unph
Gene Description ubiquitin specific peptidase 4 (proto-oncogene)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP4 (NP_003354, 676 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7375
Clone Number 5E12
Iso type IgG2a Kappa

Enviar un mensaje


USP4 monoclonal antibody (M01), clone 5E12

USP4 monoclonal antibody (M01), clone 5E12