UNG monoclonal antibody (M01), clone 4C12
  • UNG monoclonal antibody (M01), clone 4C12

UNG monoclonal antibody (M01), clone 4C12

Ref: AB-H00007374-M01
UNG monoclonal antibody (M01), clone 4C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UNG.
Información adicional
Size 100 ug
Gene Name UNG
Gene Alias DGU|DKFZp781L1143|HIGM4|UDG|UNG1|UNG15|UNG2
Gene Description uracil-DNA glycosylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UNG (AAH50634, 86 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7374
Clone Number 4C12
Iso type IgG2b Kappa

Enviar un mensaje


UNG monoclonal antibody (M01), clone 4C12

UNG monoclonal antibody (M01), clone 4C12