COL14A1 monoclonal antibody (M01), clone 5F3
  • COL14A1 monoclonal antibody (M01), clone 5F3

COL14A1 monoclonal antibody (M01), clone 5F3

Ref: AB-H00007373-M01
COL14A1 monoclonal antibody (M01), clone 5F3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COL14A1.
Información adicional
Size 100 ug
Gene Name COL14A1
Gene Alias UND
Gene Description collagen, type XIV, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TRLRYNVISHDSIQISWKAPRGKFGGYKLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COL14A1 (NP_066933, 34 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7373
Clone Number 5F3
Iso type IgG1 Kappa

Enviar un mensaje


COL14A1 monoclonal antibody (M01), clone 5F3

COL14A1 monoclonal antibody (M01), clone 5F3