UMPS monoclonal antibody (M05), clone 2F5
  • UMPS monoclonal antibody (M05), clone 2F5

UMPS monoclonal antibody (M05), clone 2F5

Ref: AB-H00007372-M05
UMPS monoclonal antibody (M05), clone 2F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UMPS.
Información adicional
Size 100 ug
Gene Name UMPS
Gene Alias OPRT
Gene Description uridine monophosphate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UMPS (NP_000364, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7372
Clone Number 2F5
Iso type IgG2b Kappa

Enviar un mensaje


UMPS monoclonal antibody (M05), clone 2F5

UMPS monoclonal antibody (M05), clone 2F5