UMPS purified MaxPab rabbit polyclonal antibody (D01P)
  • UMPS purified MaxPab rabbit polyclonal antibody (D01P)

UMPS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007372-D01P
UMPS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UMPS protein.
Información adicional
Size 100 ug
Gene Name UMPS
Gene Alias OPRT
Gene Description uridine monophosphate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UMPS (NP_000364.1, 1 a.a. ~ 480 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7372

Enviar un mensaje


UMPS purified MaxPab rabbit polyclonal antibody (D01P)

UMPS purified MaxPab rabbit polyclonal antibody (D01P)