UGT2B15 MaxPab rabbit polyclonal antibody (D01)
  • UGT2B15 MaxPab rabbit polyclonal antibody (D01)

UGT2B15 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00007366-D01
UGT2B15 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UGT2B15 protein.
Información adicional
Size 100 uL
Gene Name UGT2B15
Gene Alias UGT2B8
Gene Description UDP glucuronosyltransferase 2 family, polypeptide B15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UGT2B15 (AAI46571.1, 1 a.a. ~ 530 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7366

Enviar un mensaje


UGT2B15 MaxPab rabbit polyclonal antibody (D01)

UGT2B15 MaxPab rabbit polyclonal antibody (D01)