UGT2B10 monoclonal antibody (M01), clone 2D9
  • UGT2B10 monoclonal antibody (M01), clone 2D9

UGT2B10 monoclonal antibody (M01), clone 2D9

Ref: AB-H00007365-M01
UGT2B10 monoclonal antibody (M01), clone 2D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UGT2B10.
Información adicional
Size 100 ug
Gene Name UGT2B10
Gene Alias MGC142209
Gene Description UDP glucuronosyltransferase 2 family, polypeptide B10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGT2B10 (NP_001066, 62 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7365
Clone Number 2D9
Iso type IgG1 Kappa

Enviar un mensaje


UGT2B10 monoclonal antibody (M01), clone 2D9

UGT2B10 monoclonal antibody (M01), clone 2D9