UGP2 monoclonal antibody (M01), clone 3H3
  • UGP2 monoclonal antibody (M01), clone 3H3

UGP2 monoclonal antibody (M01), clone 3H3

Ref: AB-H00007360-M01
UGP2 monoclonal antibody (M01), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UGP2.
Información adicional
Size 100 ug
Gene Name UGP2
Gene Alias UDPG|UDPGP2|UGPP2|pHC379
Gene Description UDP-glucose pyrophosphorylase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7360
Clone Number 3H3
Iso type IgG2a Kappa

Enviar un mensaje


UGP2 monoclonal antibody (M01), clone 3H3

UGP2 monoclonal antibody (M01), clone 3H3