UGP2 purified MaxPab mouse polyclonal antibody (B01P)
  • UGP2 purified MaxPab mouse polyclonal antibody (B01P)

UGP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00007360-B01P
UGP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UGP2 protein.
Información adicional
Size 50 ug
Gene Name UGP2
Gene Alias UDPG|UDPGP2|UGPP2|pHC379
Gene Description UDP-glucose pyrophosphorylase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UGP2 (NP_006750.3, 1 a.a. ~ 508 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7360

Enviar un mensaje


UGP2 purified MaxPab mouse polyclonal antibody (B01P)

UGP2 purified MaxPab mouse polyclonal antibody (B01P)