UGCG monoclonal antibody (M03), clone 1E5
  • UGCG monoclonal antibody (M03), clone 1E5

UGCG monoclonal antibody (M03), clone 1E5

Ref: AB-H00007357-M03
UGCG monoclonal antibody (M03), clone 1E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UGCG.
Información adicional
Size 100 ug
Gene Name UGCG
Gene Alias GCS
Gene Description UDP-glucose ceramide glucosyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7357
Clone Number 1E5
Iso type IgG1 Kappa

Enviar un mensaje


UGCG monoclonal antibody (M03), clone 1E5

UGCG monoclonal antibody (M03), clone 1E5