UGCG polyclonal antibody (A01)
  • UGCG polyclonal antibody (A01)

UGCG polyclonal antibody (A01)

Ref: AB-H00007357-A01
UGCG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UGCG.
Información adicional
Size 50 uL
Gene Name UGCG
Gene Alias GCS
Gene Description UDP-glucose ceramide glucosyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7357

Enviar un mensaje


UGCG polyclonal antibody (A01)

UGCG polyclonal antibody (A01)