UCHL3 polyclonal antibody (A01)
  • UCHL3 polyclonal antibody (A01)

UCHL3 polyclonal antibody (A01)

Ref: AB-H00007347-A01
UCHL3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UCHL3.
Información adicional
Size 50 uL
Gene Name UCHL3
Gene Alias UCH-L3
Gene Description ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UCHL3 (NP_005993, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7347

Enviar un mensaje


UCHL3 polyclonal antibody (A01)

UCHL3 polyclonal antibody (A01)