UCHL1 polyclonal antibody (A02)
  • UCHL1 polyclonal antibody (A02)

UCHL1 polyclonal antibody (A02)

Ref: AB-H00007345-A02
UCHL1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UCHL1.
Información adicional
Size 50 uL
Gene Name UCHL1
Gene Alias PARK5|PGP9.5|Uch-L1
Gene Description ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UCHL1 (NP_004172, 101 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7345

Enviar un mensaje


UCHL1 polyclonal antibody (A02)

UCHL1 polyclonal antibody (A02)