UBTF monoclonal antibody (M02), clone 6C6
  • UBTF monoclonal antibody (M02), clone 6C6

UBTF monoclonal antibody (M02), clone 6C6

Ref: AB-H00007343-M02
UBTF monoclonal antibody (M02), clone 6C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBTF.
Información adicional
Size 100 ug
Gene Name UBTF
Gene Alias NOR-90|UBF
Gene Description upstream binding transcription factor, RNA polymerase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7343
Clone Number 6C6
Iso type IgG1 Kappa

Enviar un mensaje


UBTF monoclonal antibody (M02), clone 6C6

UBTF monoclonal antibody (M02), clone 6C6