UBTF polyclonal antibody (A01)
  • UBTF polyclonal antibody (A01)

UBTF polyclonal antibody (A01)

Ref: AB-H00007343-A01
UBTF polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBTF.
Información adicional
Size 50 uL
Gene Name UBTF
Gene Alias NOR-90|UBF
Gene Description upstream binding transcription factor, RNA polymerase I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7343

Enviar un mensaje


UBTF polyclonal antibody (A01)

UBTF polyclonal antibody (A01)