UBP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • UBP1 purified MaxPab rabbit polyclonal antibody (D01P)

UBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007342-D01P
UBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBP1 protein.
Información adicional
Size 100 ug
Gene Name UBP1
Gene Alias DKFZp686L1745|LBP-1B|LBP-1a|LBP1A|LBP1B
Gene Description upstream binding protein 1 (LBP-1a)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDAFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBP1 (NP_055332.2, 1 a.a. ~ 540 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7342

Enviar un mensaje


UBP1 purified MaxPab rabbit polyclonal antibody (D01P)

UBP1 purified MaxPab rabbit polyclonal antibody (D01P)