UBE2D3 monoclonal antibody (M01), clone 4C1-1E3
  • UBE2D3 monoclonal antibody (M01), clone 4C1-1E3

UBE2D3 monoclonal antibody (M01), clone 4C1-1E3

Ref: AB-H00007323-M01
UBE2D3 monoclonal antibody (M01), clone 4C1-1E3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant UBE2D3.
Información adicional
Size 100 ug
Gene Name UBE2D3
Gene Alias E2(17)KB3|MGC43926|MGC5416|UBC4/5|UBCH5C
Gene Description ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7323
Clone Number 4C1-1E3
Iso type IgG1 kappa

Enviar un mensaje


UBE2D3 monoclonal antibody (M01), clone 4C1-1E3

UBE2D3 monoclonal antibody (M01), clone 4C1-1E3