TYRO3 monoclonal antibody (M05), clone 4F6
  • TYRO3 monoclonal antibody (M05), clone 4F6

TYRO3 monoclonal antibody (M05), clone 4F6

Ref: AB-H00007301-M05
TYRO3 monoclonal antibody (M05), clone 4F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TYRO3.
Información adicional
Size 100 ug
Gene Name TYRO3
Gene Alias BYK|Brt|Dtk|FLJ16467|RSE|Sky|Tif
Gene Description TYRO3 protein tyrosine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TYRO3 (AAH49368, 50 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7301
Clone Number 4F6
Iso type IgG2a Kappa

Enviar un mensaje


TYRO3 monoclonal antibody (M05), clone 4F6

TYRO3 monoclonal antibody (M05), clone 4F6