TYK2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TYK2 purified MaxPab rabbit polyclonal antibody (D01P)

TYK2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007297-D01P
TYK2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TYK2 protein.
Información adicional
Size 100 ug
Gene Name TYK2
Gene Alias JTK1
Gene Description tyrosine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFKNESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRDFQPGRLSQQMV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TYK2 (NP_003322.2, 1 a.a. ~ 1187 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7297

Enviar un mensaje


TYK2 purified MaxPab rabbit polyclonal antibody (D01P)

TYK2 purified MaxPab rabbit polyclonal antibody (D01P)