TULP2 MaxPab mouse polyclonal antibody (B01)
  • TULP2 MaxPab mouse polyclonal antibody (B01)

TULP2 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00007288-B01
TULP2 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TULP2 protein.
Información adicional
Size 50 uL
Gene Name TULP2
Gene Alias TUBL2
Gene Description tubby like protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSCLREERLLGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLGLQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDSDHMRH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TULP2 (AAH26070, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 7288

Enviar un mensaje


TULP2 MaxPab mouse polyclonal antibody (B01)

TULP2 MaxPab mouse polyclonal antibody (B01)