TUBA2 polyclonal antibody (A01)
  • TUBA2 polyclonal antibody (A01)

TUBA2 polyclonal antibody (A01)

Ref: AB-H00007278-A01
TUBA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TUBA2.
Información adicional
Size 50 uL
Gene Name TUBA3C
Gene Alias TUBA2|bA408E5.3
Gene Description tubulin, alpha 3c
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TUBA2 (AAH11721.1, 1 a.a. ~ 418 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7278

Enviar un mensaje


TUBA2 polyclonal antibody (A01)

TUBA2 polyclonal antibody (A01)