TTC4 monoclonal antibody (M09), clone 1E10
  • TTC4 monoclonal antibody (M09), clone 1E10

TTC4 monoclonal antibody (M09), clone 1E10

Ref: AB-H00007268-M09
TTC4 monoclonal antibody (M09), clone 1E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTC4.
Información adicional
Size 100 ug
Gene Name TTC4
Gene Alias DKFZp781B0622|FLJ41930|MGC5097
Gene Description tetratricopeptide repeat domain 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMTRAPSEIDPRENPDLACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTC4 (NP_004614.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7268
Clone Number 1E10
Iso type IgG2a Kappa

Enviar un mensaje


TTC4 monoclonal antibody (M09), clone 1E10

TTC4 monoclonal antibody (M09), clone 1E10