TTC3 monoclonal antibody (M09), clone 2D10
  • TTC3 monoclonal antibody (M09), clone 2D10

TTC3 monoclonal antibody (M09), clone 2D10

Ref: AB-H00007267-M09
TTC3 monoclonal antibody (M09), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTC3.
Información adicional
Size 100 ug
Gene Name TTC3
Gene Alias DCRR1|DKFZp686M0150|RNF105|TPRDIII
Gene Description tetratricopeptide repeat domain 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTC3 (NP_003307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7267
Clone Number 2D10
Iso type IgG2a Kappa

Enviar un mensaje


TTC3 monoclonal antibody (M09), clone 2D10

TTC3 monoclonal antibody (M09), clone 2D10