TSTA3 monoclonal antibody (M01), clone 2B9
  • TSTA3 monoclonal antibody (M01), clone 2B9

TSTA3 monoclonal antibody (M01), clone 2B9

Ref: AB-H00007264-M01
TSTA3 monoclonal antibody (M01), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TSTA3.
Información adicional
Size 100 ug
Gene Name TSTA3
Gene Alias FX|P35B|SDR4E1
Gene Description tissue specific transplantation antigen P35B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq DLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSTA3 (NP_003304, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7264
Clone Number 2B9
Iso type IgG3 Kappa

Enviar un mensaje


TSTA3 monoclonal antibody (M01), clone 2B9

TSTA3 monoclonal antibody (M01), clone 2B9