TSPYL1 monoclonal antibody (M01), clone 4F11
  • TSPYL1 monoclonal antibody (M01), clone 4F11

TSPYL1 monoclonal antibody (M01), clone 4F11

Ref: AB-H00007259-M01
TSPYL1 monoclonal antibody (M01), clone 4F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TSPYL1.
Información adicional
Size 100 ug
Gene Name TSPYL1
Gene Alias TSPYL
Gene Description TSPY-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MSGLDGVKRTTPLQTHSIIISDQVPSDQDAHQYLRLRDQSEATQVMAEPGEGGSETVALPPPPPSEEGGVPQDAAGRGGTPQIRVVGGRGHVAIKAGQEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSPYL1 (NP_003300.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7259
Clone Number 4F11
Iso type IgG2a Kappa

Enviar un mensaje


TSPYL1 monoclonal antibody (M01), clone 4F11

TSPYL1 monoclonal antibody (M01), clone 4F11