TSC1 polyclonal antibody (A01)
  • TSC1 polyclonal antibody (A01)

TSC1 polyclonal antibody (A01)

Ref: AB-H00007248-A01
TSC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TSC1.
Información adicional
Size 50 uL
Gene Name TSC1
Gene Alias KIAA0243|LAM|MGC86987|TSC
Gene Description tuberous sclerosis 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LKKPGHVAEVYLVHLHASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDHELDPRRWKRLETHDVVIECAKISLDPTEASYEDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TSC1 (NP_000359, 166 a.a. ~ 274 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7248

Enviar un mensaje


TSC1 polyclonal antibody (A01)

TSC1 polyclonal antibody (A01)