TRAF6 monoclonal antibody (M02), clone 1B2
  • TRAF6 monoclonal antibody (M02), clone 1B2

TRAF6 monoclonal antibody (M02), clone 1B2

Ref: AB-H00007189-M02
TRAF6 monoclonal antibody (M02), clone 1B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRAF6.
Información adicional
Size 50 ug
Gene Name TRAF6
Gene Alias MGC:3310|RNF85
Gene Description TNF receptor-associated factor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,PLA-Ce
Immunogen Prot. Seq TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRAF6 (AAH31052, 413 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7189
Clone Number 1B2
Iso type IgG2b Kappa

Enviar un mensaje


TRAF6 monoclonal antibody (M02), clone 1B2

TRAF6 monoclonal antibody (M02), clone 1B2