NR2C2 monoclonal antibody (M01), clone 2A5
  • NR2C2 monoclonal antibody (M01), clone 2A5

NR2C2 monoclonal antibody (M01), clone 2A5

Ref: AB-H00007182-M01
NR2C2 monoclonal antibody (M01), clone 2A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NR2C2.
Información adicional
Size 100 ug
Gene Name NR2C2
Gene Alias TAK1|TR2R1|TR4|hTAK1
Gene Description nuclear receptor subfamily 2, group C, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,ELISA,RNAi-Ab
Immunogen Prot. Seq KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR2C2 (NP_003289, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7182
Clone Number 2A5
Iso type IgG1 Kappa

Enviar un mensaje


NR2C2 monoclonal antibody (M01), clone 2A5

NR2C2 monoclonal antibody (M01), clone 2A5