TPSAB1 monoclonal antibody (M01), clone 2A10-B5
  • TPSAB1 monoclonal antibody (M01), clone 2A10-B5

TPSAB1 monoclonal antibody (M01), clone 2A10-B5

Ref: AB-H00007177-M01
TPSAB1 monoclonal antibody (M01), clone 2A10-B5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TPSAB1.
Información adicional
Size 100 ug
Gene Name TPSAB1
Gene Alias MCP7|TPS1|TPS2|TPSB1
Gene Description tryptase alpha/beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MLSLLLLALPVLASPAYAAPAPVQALQQAGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPSAB1 (AAH28059, 1 a.a. ~ 275 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7177
Clone Number 2A10-B5
Iso type IgG2a kappa

Enviar un mensaje


TPSAB1 monoclonal antibody (M01), clone 2A10-B5

TPSAB1 monoclonal antibody (M01), clone 2A10-B5