TPSAB1 purified MaxPab mouse polyclonal antibody (B02P)
  • TPSAB1 purified MaxPab mouse polyclonal antibody (B02P)

TPSAB1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00007177-B02P
TPSAB1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TPSAB1 protein.
Información adicional
Size 50 ug
Gene Name TPSAB1
Gene Alias MCP7|TPS1|TPS2|TPSB1
Gene Description tryptase alpha/beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPSAB1 (NP_003285, 1 a.a. ~ 275 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7177

Enviar un mensaje


TPSAB1 purified MaxPab mouse polyclonal antibody (B02P)

TPSAB1 purified MaxPab mouse polyclonal antibody (B02P)