TPSAB1 polyclonal antibody (A01)
  • TPSAB1 polyclonal antibody (A01)

TPSAB1 polyclonal antibody (A01)

Ref: AB-H00007177-A01
TPSAB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TPSAB1.
Información adicional
Size 50 uL
Gene Name TPSAB1
Gene Alias MCP7|TPS1|TPS2|TPSB1
Gene Description tryptase alpha/beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MLSLLLLALPVLASPAYAAPAPVQALQQAGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPSAB1 (AAH28059, 1 a.a. ~ 275 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 7177

Enviar un mensaje


TPSAB1 polyclonal antibody (A01)

TPSAB1 polyclonal antibody (A01)