TPR monoclonal antibody (M01), clone 1A8
  • TPR monoclonal antibody (M01), clone 1A8

TPR monoclonal antibody (M01), clone 1A8

Ref: AB-H00007175-M01
TPR monoclonal antibody (M01), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPR.
Información adicional
Size 100 ug
Gene Name TPR
Gene Alias -
Gene Description translocated promoter region (to activated MET oncogene)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLELEKLNNQLKALTEKNKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPR (NP_003283, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7175
Clone Number 1A8
Iso type IgG1 Kappa

Enviar un mensaje


TPR monoclonal antibody (M01), clone 1A8

TPR monoclonal antibody (M01), clone 1A8