TPO monoclonal antibody (M08), clone 2A11
  • TPO monoclonal antibody (M08), clone 2A11

TPO monoclonal antibody (M08), clone 2A11

Ref: AB-H00007173-M08
TPO monoclonal antibody (M08), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPO.
Información adicional
Size 100 ug
Gene Name TPO
Gene Alias MSA|TPX
Gene Description thyroid peroxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPO (NP_000538.3, 672 a.a. ~ 779 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7173
Clone Number 2A11
Iso type IgG2b Kappa

Enviar un mensaje


TPO monoclonal antibody (M08), clone 2A11

TPO monoclonal antibody (M08), clone 2A11