TPO purified MaxPab rabbit polyclonal antibody (D01P)
  • TPO purified MaxPab rabbit polyclonal antibody (D01P)

TPO purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00007173-D01P
TPO purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TPO protein.
Información adicional
Size 100 ug
Gene Name TPO
Gene Alias MSA|TPX
Gene Description thyroid peroxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSAAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHDIAFTPQSTSKAAFGG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPO (AAH95448.1, 1 a.a. ~ 933 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7173

Enviar un mensaje


TPO purified MaxPab rabbit polyclonal antibody (D01P)

TPO purified MaxPab rabbit polyclonal antibody (D01P)