TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)
  • TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)

TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00007164-B02P
TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TPD52L1 protein.
Información adicional
Size 50 ug
Gene Name TPD52L1
Gene Alias D53|MGC8556|TPD52L2|hD53
Gene Description tumor protein D52-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPD52L1 (NP_003278.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7164

Enviar un mensaje


TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)

TPD52L1 purified MaxPab mouse polyclonal antibody (B02P)