TPD52 monoclonal antibody (M01), clone 1B6
  • TPD52 monoclonal antibody (M01), clone 1B6

TPD52 monoclonal antibody (M01), clone 1B6

Ref: AB-H00007163-M01
TPD52 monoclonal antibody (M01), clone 1B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TPD52.
Información adicional
Size 100 ug
Gene Name TPD52
Gene Alias D52|N8L|PC-1|PrLZ|hD52
Gene Description tumor protein D52
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 7163
Clone Number 1B6
Iso type IgG2b Kappa

Enviar un mensaje


TPD52 monoclonal antibody (M01), clone 1B6

TPD52 monoclonal antibody (M01), clone 1B6